PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00576.1.g00290.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 61aa    MW: 6877.2 Da    PI: 11.5453
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00576.1.g00290.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.65.1e-261056248
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                                  rien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gkly+
  Zpz_sc00576.1.g00290.1.sm.mk 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDARIGIIIFSAHGKLYD 56
                                  8********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-25159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.492161IPR002100Transcription factor, MADS-box
CDDcd002658.40E-34261No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ARIGIIIFSA HGKLYDLATT  60
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-16361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-16361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-16361260Myocyte-specific enhancer factor 2A
3kov_B1e-16361260Myocyte-specific enhancer factor 2A
3kov_I1e-16361260Myocyte-specific enhancer factor 2A
3kov_J1e-16361260Myocyte-specific enhancer factor 2A
3mu6_A7e-17361260Myocyte-specific enhancer factor 2A
3mu6_B7e-17361260Myocyte-specific enhancer factor 2A
3mu6_C7e-17361260Myocyte-specific enhancer factor 2A
3mu6_D7e-17361260Myocyte-specific enhancer factor 2A
3p57_A1e-16361260Myocyte-specific enhancer factor 2A
3p57_B1e-16361260Myocyte-specific enhancer factor 2A
3p57_C1e-16361260Myocyte-specific enhancer factor 2A
3p57_D1e-16361260Myocyte-specific enhancer factor 2A
3p57_I1e-16361260Myocyte-specific enhancer factor 2A
3p57_J1e-16361260Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3704681e-63AK370468.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111D24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443744.19e-36hypothetical protein SORBIDRAFT_07g001250
SwissprotA2YQK93e-36MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G83e-36MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLI1I0F86e-37I1I0F8_BRADI; Uncharacterized protein
STRINGSb07g001250.13e-35(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-34AGAMOUS-like 12